PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB01G18340.1
Common NameLOC102701112
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 1000aa    MW: 110378 Da    PI: 5.0708
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB01G18340.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.22.2e-1955101148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT+eEd +l +av+ + g++Wk+Ia++++ gRt+ qc +rwqk+l
     OB01G18340.1  55 KGNWTPEEDAILSRAVQTYNGKNWKKIAECFP-GRTDVQCLHRWQKVL 101
                      79******************************.************986 PP

2Myb_DNA-binding60.63.3e-19107153148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+W++eEd+++v+ v++lG++ W+tIa+ ++ gR +kqc++rw+++l
     OB01G18340.1 107 KGPWSKEEDDIIVQMVNKLGPKKWSTIAQALP-GRIGKQCRERWYNHL 153
                      79******************************.*************97 PP

3Myb_DNA-binding43.57.4e-14159201145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      + +WT+ E+  l++a++++G++ W+   + ++ gRt++ +k++w+
     OB01G18340.1 159 KEAWTQKEEITLIHAHRMYGNK-WAELTKFLP-GRTDNAIKNHWN 201
                      579*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.30750101IPR017930Myb domain
SuperFamilySSF466893.73E-2053116IPR009057Homeodomain-like
SMARTSM007171.3E-1754103IPR001005SANT/Myb domain
PfamPF002494.9E-1755101IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-2457118IPR009057Homeodomain-like
CDDcd001674.56E-1557101No hitNo description
PROSITE profilePS5129430.712102157IPR017930Myb domain
SuperFamilySSF466897.49E-30104200IPR009057Homeodomain-like
SMARTSM007177.7E-18106155IPR001005SANT/Myb domain
PfamPF002492.2E-17107153IPR001005SANT/Myb domain
CDDcd001671.64E-15109153No hitNo description
Gene3DG3DSA:1.10.10.607.7E-25119160IPR009057Homeodomain-like
PROSITE profilePS5129418.587158208IPR017930Myb domain
SMARTSM007175.8E-13158206IPR001005SANT/Myb domain
PfamPF002492.1E-12159202IPR001005SANT/Myb domain
CDDcd001677.38E-10161201No hitNo description
Gene3DG3DSA:1.10.10.601.6E-20161208IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0032875Biological Processregulation of DNA endoreduplication
GO:0003677Molecular FunctionDNA binding
GO:0003713Molecular Functiontranscription coactivator activity
Sequence ? help Back to Top
Protein Sequence    Length: 1000 aa     Download sequence    Send to blast
MSSLAMTTNS GKDPNKGREA SGPPSAPQEG EISKEPQRRR PLNGRTTGPT RRSTKGNWTP  60
EEDAILSRAV QTYNGKNWKK IAECFPGRTD VQCLHRWQKV LNPELVKGPW SKEEDDIIVQ  120
MVNKLGPKKW STIAQALPGR IGKQCRERWY NHLNPGINKE AWTQKEEITL IHAHRMYGNK  180
WAELTKFLPG RTDNAIKNHW NSSVKKKVDS YMSSGLLTQV SSLPLNEYSA HCNSSPAMTQ  240
QNSEDSGCFA VQEVENSSGC SQSSLAKVSC SQVHNTSVAL GCDLQTNGNV DKNETHDSQS  300
SMGHEACYTS AEAAASVMTD VHYHVSSSNF DPDQHLQEDF AQGLNLHMSI DEMPSAPNSA  360
DNQSLCSIEN HERSLESYDV EMEMPLSLLP SDSGAEQKLH FMSEADFNSP NCLKSELWQD  420
ISLQSLLSGP DAVQTDCFSR LNQQSDAHSS KADTHFLAPS CPLQTSNPSC VMEDAYDQSP  480
QMSVPPSLIC SNVMTDAPSD NRPEPKEMPL SQAEMVMQSS SSSGDAEMFA NPGSSNDWHV  540
PSSTMGRIPE FGHQQVTNVE EPKASVEKEP SLTQSMTAPD EKKEQEEGAL FYEPPRFPSV  600
DVPFVSCDLV TSEDLQEYSP LGIRQLMHST MNVCTPIRLW GSPTHDGSPD VLLKSVAKSF  660
ICTPSILKKR HRDFLSPIPD KRIEKKCVTD KDRGVSYTSS TGIQTCFNAT NDDSLITKSV  720
LRIERSASSK PLEKNLFSDE NKENWTYTTE QAKDGQSAKN DEHMDEQARQ ERHSTTNIAT  780
TYDDLPGNLQ PAGILVEHSS DDLVSPAYDK NTMNQKLNTN IEPLSVCKEG VCAKSKPKEL  840
IVEKSSPCIN VDYEYVNIFA DTPGIKRGLE SPSAWKSPWF VDMQFQGSYF VSPADRTYDA  900
LGLVKQINVQ TAAALAEARE VLASGGQCDN INSDKENMQN PDAKEEPGAT KLPTKIMAEA  960
RILDFNECTP VRSSDKNAGS SLGRSLGSPI PSSNLLKSFR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C5e-64552086159MYB PROTO-ONCOGENE PROTEIN
1h89_C5e-64552086159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00505DAPTransfer from AT5G11510Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3186010.0AK318601.1 Oryza sativa Japonica Group cDNA, clone: J100066E24, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006643940.10.0PREDICTED: myb-related protein 3R-1-like
TrEMBLJ3KXX80.0J3KXX8_ORYBR; Uncharacterized protein
STRINGOB01G18340.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24953879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11510.21e-106myb domain protein 3r-4